PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1133s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 596aa    MW: 65315.1 Da    PI: 6.0653
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1133s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3325.11.9e-99128560303
                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHH CS
                 EIN3  60 MlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLs 149
                          Mlk +evcna+GfvYgiip+kgkpv+gasd+Lr+WWke v+fd+n +aa+ ky+a++l++++ + + + + ++  +l++lqD+tlgSLLs
  Kalax.1133s0002.1.p   1 MLKLVEVCNARGFVYGIIPDKGKPVSGASDNLRGWWKETVKFDKNSTAALDKYEAECLAMGKLNAN-V-NGNSRGMLQDLQDATLGSLLS 88 
                          9**********************************************************9976666.4.89999**************** PP

                          HHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT-- CS
                 EIN3 150 almqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkms 239
                          +l+qhcdppqr++plekg++pPWWPtG+e+ww +lgl+++q+ ppy+kphdlkk+wkv+vLtavikhmsp+i++i++l +qsk+lqdkm+
  Kalax.1133s0002.1.p  89 SLIQHCDPPQRKYPLEKGIPPPWWPTGEEDWWVKLGLPASQS-PPYRKPHDLKKMWKVGVLTAVIKHMSPDITKIKRLILQSKCLQDKMT 177
                          *****************************************9.9********************************************** PP

                          SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXXXXXXXXXXX.............XXXXXX.XXXXXXXXXX........... CS
                 EIN3 240 akesfallsvlnqeekecatvsah..ss.slrkqspkvtlsceqkedve.............gkkeskikhvqavktta........... 302
                          ake+ ++l+vl++ee+++    ++  s  s   qs + ++ +e++ dv              g   +k          +           
  Kalax.1133s0002.1.p 178 AKETTIWLAVLSHEESLISLTITSdlSDvSGDGQSGNRQVATENNHDVSitdmevasglpkkG---RK----------Nqtvdsvvesql 254
                          ****************99765555453354455888888888888888875655444442221...11..........112234445556 PP

                          ..............................X CS
                 EIN3 303 ..............................g 303
                                                        +
  Kalax.1133s0002.1.p 255 hvestrnpirvgkqvknrgkkqpskrnpviQ 285
                          6677777777744444443333333333330 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.1E-981192No hitNo description
Gene3DG3DSA:1.10.3180.105.5E-6868196IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-5974194IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MLKLVEVCNA RGFVYGIIPD KGKPVSGASD NLRGWWKETV KFDKNSTAAL DKYEAECLAM  60
GKLNANVNGN SRGMLQDLQD ATLGSLLSSL IQHCDPPQRK YPLEKGIPPP WWPTGEEDWW  120
VKLGLPASQS PPYRKPHDLK KMWKVGVLTA VIKHMSPDIT KIKRLILQSK CLQDKMTAKE  180
TTIWLAVLSH EESLISLTIT SDLSDVSGDG QSGNRQVATE NNHDVSITDM EVASGLPKKG  240
RKNQTVDSVV ESQLHVESTR NPIRVGKQVK NRGKKQPSKR NPVIQDGTPQ SSDNLPVEEV  300
RSAPLNQLTD SVGDRPPHND GHSVSAGYEV NAAEKNRKRR RVSHDPVARE PGLQSKNSFV  360
AEDVLSVSAD KNHVEASSFE IQAHYTSHQN KQPVILQQSQ ENDMGAQPYR VLPSTNLSPA  420
QSMYLGWLPL PSSVPHPAAN NCGTEHQMYN ASGNYGTNYI QSSGTAAYEH AQNGLQDAVI  480
QPQILQDQPA GLAVRVDSNP YVVGTFHNGA RKEVAEGYLN PDALGNDNSQ ILVTGGGLNP  540
CVQGTLDSNQ DMPFEGLDFS FNDMPMDFEG FNSPLSLNDL DFFLNDSDML EHMAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-717419511132ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1336340RKRRR
2337341KRRRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9GMA11e-123B9GMA1_POPTR; ETHYLENE-INSENSITIVE3-like 3 family protein
STRINGPOPTR_0001s05360.11e-123(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-109ETHYLENE-INSENSITIVE3-like 3